SILU(TM)PROT INSULIN HUMAN

Code: MSST0064-10UG D2-231

Biochem/physiol Actions

Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, prote...


read more

Your Price
€768.20 10UG
€944.89 inc. VAT

Biochem/physiol Actions

Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat.

General description

SILu Prot Insulin is a recombinant, stable 15N isotope-labeled human Insulin Expressed in P. pastoris, it is designed to be used as an internal standard for bioanalysis of Insulin in mass-spectrometry. SILu Prot Insulin is a disulfate bonded hetero-dimer protein composed of two chains. Chain A of 21 amino acids and a thoretical amolecular mass of 2408.5; Chain B of 30 amino acids and a thoretical amolecular mass of 3468.7 (Note that Thr30 in chain B is not 15N labeled).

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

Physical form

Supplied as dried pellet from a solution containing 1% acetic acid.

Sequence

A chain: GIVEQCCTSICSLYQLENYCNB chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT

assay≥95% (HPLC)
formdry pellets
Gene Informationhuman ... INS(3630)
potency≥97% (Heavy amino acids incorporation efficiency by MS)
Quality Level200
recombinantexpressed in Pichia pastoris
shipped inambient
storage temp.−20°C
suitabilitysuitable for mass spectrometry (standard)
UniProt accession no.P01308 (25-54, B chain; 90-110, A chain)
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.