Anti-STIP1

Code: av46165-100ul D2-231

Application

Anti-STIP1 (AB2) polyclonal antibody is used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by Western blo...


 Read more

Your Price
€350.00 100UL
€430.50 inc. VAT

Application

Anti-STIP1 (AB2) polyclonal antibody is used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) in the management of protein refolding by heat shock proteins such as Hsp70 and Hsp90.

Biochem/physiol Actions

STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) (STIP1, HOP, IEF-SSP-3521, STI1, STI1L, P60) is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 links the chaperones Hsp70 and Hsp90 together to facilitate their function. HOP ensures the productive folding of substrate proteins by controlling the chaperone activities of HSP70 and HSP90.

Immunogen

Synthetic peptide directed towards the C terminal region of human STIP1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

Specificity

Anti-STIP1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, and canine stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) proteins..

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... STIP1(10963)
mol wt63 kDa
NCBI accession no.NP_006810
Quality Level100
shipped inwet ice
species reactivitymouse, human, dog, rat, rabbit, horse, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P31948
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.