Application
Anti-STIP1 (AB2) polyclonal antibody is used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) in the management of protein refolding by heat shock proteins such as Hsp70 and Hsp90.
Biochem/physiol Actions
STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) (STIP1, HOP, IEF-SSP-3521, STI1, STI1L, P60) is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 links the chaperones Hsp70 and Hsp90 together to facilitate their function. HOP ensures the productive folding of substrate proteins by controlling the chaperone activities of HSP70 and HSP90.
Immunogen
Synthetic peptide directed towards the C terminal region of human STIP1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
Specificity
Anti-STIP1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, and canine stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) proteins..
This product has met the following criteria to qualify for the following awards: