ANTI-AMIGO2 (N-TERMINAL) ANTIBODY PRODU

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

AMIGO2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3 abd may contribute to signal transduction through its intracellular domain. It also may be required for tumorigenesis of a subset of gastric adenocarcinomas.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human AMIGO2

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL