SAB2108921-100UL Display Image


Code: SAB2108921-100UL D2-231


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...

read more

Your Price
€414.00 100UL
€509.22 inc. VAT


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

GPR120 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide


Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
concentration0.5 mg/mL
conjugateperoxidase conjugate
formbuffered aqueous solution
Gene Informationhuman ... FFAR4(338557)
mol wt41 kDa
NCBI accession no.NM_025079
shipped inwet ice
species reactivity (predicted by homology)rabbit, horse, human, bovine, rat, canine, guinea pig, mouse
storage temp.−20°C
This product has met the following criteria: