Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Piezos are large transmembrane proteins conserved among various species, all having between 24 and 36 predicted transmembrane domains. ′Piezo′ comes from the Greek ′piesi,′ meaning ′pressure.′ The PIEZO2 protein has a role in rapidly adapting mechanically activated (MA) currents in somatosensory neurons.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human PIEZO2

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK