Biochem/physiol Actions

S100b binds GTPase activating protein IQGAP1; It may play a role in cell membrane rearrangement.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-S100B antibody: synthetic peptide directed towards the N terminal of human S100B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMA