ANTI-SERPINA3

Code: SAB2108215-100UL D2-231

Biochem/physiol Actions

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) can block the functions of various serine proteases like chymotrypsin and cathepsin G. It serv...


read more

Your Price
€588.00 100UL
€723.24 inc. VAT

Biochem/physiol Actions

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) can block the functions of various serine proteases like chymotrypsin and cathepsin G. It serves as a novel predictor of clinical outcomes and a potential therapeutic target of EC (endometrial carcinoma). SERPINA3 plays a major role in melanoma invasion and migration in extracellular matrix.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) is also termed as α1-antichymotrypsin (α1-ACT). It is a 68 kDa serine protease inhibitor, secreted by the liver. It belongs to the serpin superfamily of protease inhibitors. SERPINA3 is located on human chromosome 14q32.1.

Immunogen

Synthetic peptide directed towards the middle region of human SERPINA3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SERPINA3(12)
mol wt45kDa
NCBI accession no.NM_001085
Quality Level100
shipped inwet ice
species reactivityrat, mouse, human
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.P01011
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.