ANTI-KLF4

Code: SAB2107958-100UL D2-231

Biochem/physiol Actions

The mammalian Kruppel-like transcription factor, KLF4 is involved in preventing centrosome amplification following DNA damage caused by gamma-irradiat...


 Read more

Your Price
€500.00 100UL
€615.00 inc. VAT

Biochem/physiol Actions

The mammalian Kruppel-like transcription factor, KLF4 is involved in preventing centrosome amplification following DNA damage caused by gamma-irradiation. It is both necessary and sufficient in preventing centrosome amplification following gamma-radiation-induced DNA damage and does so by transcriptionally suppressing cyclin E expression n. Kruppel-like factor 4 is also known to exhibit checkpoint function during the G1/S and G2/M transitions of the cell cycle.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human KLF4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KLF4(9314)
mol wt50kDa
NCBI accession no.NM_004235
Quality Level100
shipped inwet ice
species reactivityrabbit, dog, horse, bovine, rat, mouse, guinea pig, human
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.O43474
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.