Anti-SLC2A6

Biochem/physiol Actions

Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, which contains 12 transmembrane domains and a number of critical conserved residues.Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.[supplied by OMIM].

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC2A6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV