Anti-IL15

Biochem/physiol Actions

Interleukin-15 (IL-15) can activate inflammatory cell recruitment, angiogenesis, and synthesis of other inflammatory cytokines. It plays a key role in the progression, homeostatic proliferation, and activation of natural killer (NK) cells, natural killer T (NKT) cells, and intestinal intraepithelial lymphocytes (IELs). IL-15 plays a crucial role in the homeostatic modulation of the cluster of differentiation 8 (CD8) memory T cells. IL-15 upregulates the expression of telomerase and aids in enhancing the proliferative capacity of NK, NKT-like, and CD8 T Cells. Mutation in the IL-15 gene results in psoriasis vulgaris.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Interleukin-15 (IL-15), a cytokine, belongs to the 4α-helix bundle cytokine family. IL-15 gene is located on human chromosome 4q31.2.

Immunogen

Synthetic peptide directed towards the N terminal region of human IL15

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV