Anti-HMG20A

Code: SAB2101047-100UL D2-231

Biochem/physiol Actions

HMG20A (high mobility group 20A) plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the ...


read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Biochem/physiol Actions

HMG20A (high mobility group 20A) plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also acts as an inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4.HMG20A is essential for SNAI1 (snail family transcriptional repressor 1)-mediated epithelial to mesenchymal transition.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HMG20A (high mobility group 20A) is located on human chromosome 15q24. It is a high mobility group (HMG) domain-containing protein.

Immunogen

Synthetic peptide directed towards the N terminal region of human HMG20A

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HMG20A(10363)
mol wt40 kDa
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NP66
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.