Anti-LGALS3BP

Code: AV54779-100UL D2-231

Application

Anti-LGALS3BP antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions


 Read more

Your Price
€449.00 100UL
€552.27 inc. VAT

Application

Anti-LGALS3BP antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

LGALS3BP (Lectin, galactoside-binding, soluble, 3 binding protein) or MAC-2-BP gene encodes a Galectin-3-binding protein localized to chromosome 17q25. It is widely expressed by keratinocytes and fibroblasts but is also present in fluids like- semen, milk, serum, tears, saliva and urine. LGALS3BP stimulates the intergrin-mediated cell adhesion. It also imposes stimulatory impact on host defense system like natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Furthermore, the encoded protein interacts specifically with galectin-1 and galectin-3 and facilitates the formation of multicell aggregates.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human LGALS3BP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... LGALS3BP(3959)
mol wt63 kDa
NCBI accession no.XP_001726175
Quality Level100
shipped inwet ice
species reactivitymouse, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q08380
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.