Application
Anti-EPHX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Biochem/physiol Actions
EPHX1 [Epoxide hydrolase 1, microsomal (xenobiotic)] gene encodes a biotransformation enzyme that metabolizes arene and aliphatic epoxides to more water-soluble trans-dihydrodiol derivatives. It also plays a pivotal role in carcinogen metabolism and facilitates the sodium-dependent uptake of bile acids into hepatocytes. Mutation in EPHX1 gene results in preeclampsia, which causes increased epoxide hydrolase activity or epoxide hydrolase deficiency.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human EPHX1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI
This product has met the following criteria to qualify for the following awards: