Anti-BCKDK

Code: AV52131-100UL D2-231

Biochem/physiol Actions

BCKDK belongs to the PDK/BCKDK protein kinase family. It contains 1 histidine kinase domain. BCKDK catalyzes the phosphorylation and inactivation of t...


 Read more

Your Price
€449.00 100UL
€552.27 inc. VAT

Biochem/physiol Actions

BCKDK belongs to the PDK/BCKDK protein kinase family. It contains 1 histidine kinase domain. BCKDK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCKDK is the key enzyme that regulates the activity state of the BCKD complex.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human BCKDK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... BCKDK(10295)
mol wt43 kDa
NCBI accession no.NP_005872
Quality Level100
shipped inwet ice
species reactivityhuman, pig, rat, bovine, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O14874
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.