Anti-FAM20C

Code: AV49490-100UL D2-231

Application

Anti-FAM20C (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions...


 Read more

Your Price
€520.00 100UL
€639.60 inc. VAT

Application

Anti-FAM20C (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

FAM20C (Family with sequence similarity 20, member C) is a secretory Golgi casein kinase involved in biomineralization, enamel formation, lipid homeostasis, wound healing, cell migration and adhesion. It has ability to phosphorylate S-x-E/pS motifs on proteins present in milk and in the extracellular matrix of bones and teeth. During enamel formation, it forms a functional complex by binding to a pseudokinase, Fam20A, which triggers extracellular protein phosphorylation within the secretory pathway. Mutations in FAM20C gene cause Raine syndrome, hypophosphatemia, hyperphosphaturia, dental anomalies, intracerebral calcifications and osteosclerosis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

FAM20C (Family with sequence similarity 20, member C) is a member of FAM20 protein family. It is distributed in several mammalian cell lines. During hematopoietic differentiation, it is expressed in hematopoietic cells.

Immunogen

Synthetic peptide directed towards the C terminal region of human FAM20C

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FAM20C(56975)
mol wt66 kDa
NCBI accession no.NP_064608
Quality Level100
shipped inwet ice
species reactivitymouse, dog, horse, human, guinea pig, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IXL6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.