Application

Anti-TMTC2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Transmembrane and tetratricopeptide repeat containing 2 (TMTC2) is tetratricopeptide repeats (TPR)-containing integral membrane adapter protein present in the endoplasmic reticulum (ER). TMTC1 and TMTC2 bind the carbohydrate-binding chaperone calnexin and regulate calcium homeostasis in the ER.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TMTC2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK