Anti-TRMT11

Code: AV48526-100UL D2-231

Application

Rabbit Anti-TRMT11 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

TRMT...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Rabbit Anti-TRMT11 antibody is suitable for western blot applications at a concentration of 1µg/ml.

Biochem/physiol Actions

TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

TRMT11-1 codes for tRNA Methyltransferase 11 homolog (S. cerevisiae). It may be involved in the processing of tRNA. Genetic variation in TRMT11 has been analyzed as a biomarker to predict the efficacy of androgen deprivation therapy in prostate cancer patients.Rabbit Anti-TRMT11 antibody recognizes human, mouse, rat, chicken, canine, and bovine TRMT11.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRMT11

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TRMT11(60487)
mol wt53 kDa
NCBI accession no.NP_001026882
Quality Level100
shipped inwet ice
species reactivitymouse, human, guinea pig, rabbit, rat, horse, bovine, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q7Z4G4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.