AV48056-100UL Display Image

Anti-ST14

Code: AV48056-100UL D2-231

Application

Rabbit Anti-ST14 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml and for IHC at 4-8 µg/ml.

Biochem/phy...


read more

Your Price
€523.00 100UL

Application

Rabbit Anti-ST14 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml and for IHC at 4-8 µg/ml.

Biochem/physiol Actions

ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Suppression of tumorigenicity 14 (colon carcinoma) (ST14) is an intergral membrane serine protease that forms a complex with HAI-1. It is known to inhibit cell growth and functions as a target for miR-27b. Mutations in ST14 have been linked to icthyosis.Rabbit Anti-ST14 antibody recognizes human, mouse, rat, bovine, and rabbit ST14.

Immunogen

Synthetic peptide directed towards the C terminal region of human ST14

Sequence

Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
Gene Informationhuman ... ST14(6768)
mol wt95 kDa
NCBI accession no.NP_068813
packagingpkg of 50 µg lyophilized powder, pkg of 100 µL buffered aqueous solution
Quality Level100
species reactivityhuman, bovine, horse, rat, pig, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9Y5Y6
This product has met the following criteria:



Quantity
Est. Dispatch/Availability