Application

Anti-SV2A antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/mL.

Biochem/physiol Actions

SV2A (synaptic vesicle glycoprotein 2A) gene is a multi-pass membrane protein that belongs to major facilitator superfamily. It regulates the cytoplasmic Ca²⁺ levels in the nerve terminal during repetitive stimulation and facilitates the synaptic transmission. SV2A serves as a binding site for the antiepileptic drug levetiracetam and may decrease the neuronal excitability. Mutation in SV2A gene results in schizophrenia.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human SV2A

Sequence

Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT