Anti-RTN4

Code: AV46812-100UL D2-231

Application

Anti-RTN4 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mLl.

Biochem/physiol Actions

 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-RTN4 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mLl.

Biochem/physiol Actions

RTN4 (reticulon 4) gene is a member of reticulon encoding genes family. It is expressed in oligodendrocytes and predominantly associates with the endoplasmic reticulum. It is a component of CNS white matter that inhibits the axonal regeneration and induces collapse in dorsal root ganglion growth cones. Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease that plays a pivotal role in the generation of amyloid beta-protein (Abeta). RTN4 interacts with BACE1 and blocks its activity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human RTN4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RTN4(57142)
mol wt42 kDa
NCBI accession no.NP_997403
Quality Level100
shipped inwet ice
species reactivityrat, bovine, human, mouse, sheep, pig, rabbit, horse, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NQC3
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.