Anti-VAMP5

Code: AV46751-100UL D2-231

Application

Anti-VAMP5 antibody produced in rabbit is suitable for western blotting at a concentration of 5µg/mL.

Biochem/physiol Actions

VA...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Anti-VAMP5 antibody produced in rabbit is suitable for western blotting at a concentration of 5µg/mL.

Biochem/physiol Actions

VAMP5 (vesicle-associated membrane protein 5) gene encodes a 116 amino acid containing single-pass type IV membrane protein that belongs to the synaptobrevin family and the SNARE superfamily. It plays a pivotal role vesicle trafficking events that are associated with myogenesis like- myoblast fusion and/or GLUT4 trafficking. VAMP5 protein is localized in skeletal muscle, heart, spleen, lung, liver, and kidney tissue and facilitates the membrane trafficking in skeletal and cardiac muscle.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human VAMP5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... VAMP5(10791)
mol wt13 kDa
NCBI accession no.NP_006625
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O95183
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.