Anti-TSPAN32

Code: AV46636-100UL D2-231

Application

Anti-TSPAN32 (AB2) antibody produced in rabbit has been used for western blotting at a concentration of 5µg/ml. It has also been used for immunohistochemistr...


 Read more

Your Price
€396.00 100UL
€487.08 inc. VAT

Application

Anti-TSPAN32 (AB2) antibody produced in rabbit has been used for western blotting at a concentration of 5µg/ml. It has also been used for immunohistochemistry at a concentration of 4-8µg/ml.

Biochem/physiol Actions

TSPAN32 encodes for tetraspanin 32 protein, that belongs to tetraspanin superfamily and is expressed mainly in hematopoietic tissues comprising peripheral blood leukocytes, thymus and spleen. It plays a crucial role in hematopoietic cell function. Additionally, it also facilitates the gulating T cell proliferation responses in vitro. TSSC6 along with CD37 regulates the antipathogen cellular immunity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TSPAN32

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TSPAN32(10077)
mol wt31 kDa
NCBI accession no.NP_620591
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q96QS1-2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.