Anti-MTHFD2

Code: AV46038-100UL D2-231

Application

Anti-MTHFD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions

<...


 Read more

Your Price
€396.00 100UL
€487.08 inc. VAT

Application

Anti-MTHFD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml.

Biochem/physiol Actions

MTHFD2 encodes a mitochondrial bifunctional enzyme methylenetetrahydrofolate dehydrogenase/cyclohydrolase with NAD-dependent methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase domain. Decrease in MTHFD2 expression leads to impairment of cell migration and invasion into extracellular matrix and reduces the cell fraction with a high CD44 expression. It facilitates the regulation of breast cancer cell migration and invasion.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human MTHFD2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MTHFD2(10797)
mol wt35 kDa
NCBI accession no.NP_001035499
Quality Level100
shipped inwet ice
species reactivitybovine, guinea pig, horse, rat, rabbit, human, dog, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P13995
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.