Anti-SLC30A1

Code: AV44019-100UL D2-231

Application

Anti-SLC30A1 polyclonal antibody is used to tag solute carrier family 30, member 1 for detection and quantitation by Western blotting and in plasma by immunohisto...


 Read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Application

Anti-SLC30A1 polyclonal antibody is used to tag solute carrier family 30, member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 30, member 1 in divalent cation (Zn2+, Cd2+, Ca2+) homeostasis, especially in conjunction with L-type voltage-dependent calcium channels.

Biochem/physiol Actions

SLC30A1 may be involved in zinc transport out of the cell.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 30, member 1 (SLC30A1, ZNT1, ZRC1) is a zinc transporter involved in regulating zinc and other divalent cation flux. SLC30A1/ ZNT1 is frequently coexpressed with L-type voltage-dependent calcium channel (LTCC), a major route for zinc influx. SLC30A1/ ZNT1 is believed to regulate cellular ion (calcium, cadmium, zinc) homeostasis, at least in part, by modulating/inhibiting L-type calcium channels.

Immunogen

Synthetic peptide directed towards the middle region of human SLC30A1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY

Specificity

Anti-SLC30A1 polyclonal antibody reacts with human, canine, and pig solute carrier family 30, member 1/ZNT1 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC30A1(7779)
mol wt55 kDa
NCBI accession no.NP_067017
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9Y6M5
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.