Anti-SLC7A1

Code: AV43838-100UL D2-231

Application

Anti-SLC7A1 polyclonal antibody is used to tag Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 for detection and quantitation by We...


 Read more

Your Price
€432.00 100UL
€531.36 inc. VAT

Application

Anti-SLC7A1 polyclonal antibody is used to tag Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 in cationic amino acid uptake and retrovirus infection mechanisms and pathogenesis.

Biochem/physiol Actions

SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1/ high affinity cationic amino acid transporter 1 (SLC7A1, ATRC1, CAT-1, ERR, REC1L) is a y+ system cationic amino acid transporter family member that supports arginine uptake and nitric oxide (NO) production. Mouse CAT-1 is a viral receptor for ecotropic murine leukemia virus (MLV) (eMLV), making it a model for study of retrovirus infection mechanisms and pathogenesis.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC7A1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF

Specificity

Anti-SLC7A1 polyclonal antibody reacts with human and pig solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC7A1(6541)
mol wt68 kDa
NCBI accession no.NP_003036
Quality Level100
shipped inwet ice
species reactivityhuman, rabbit, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P30825
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.