Anti-PLUNC

Code: AV42475-100UL D2-231

Application

Anti-PLUNC polyclonal antibody is used to tag palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts (PLUNC1) for de...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Anti-PLUNC polyclonal antibody is used to tag palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts (PLUNC1) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts in defense against Gram-negative bacterial-induced respiratory infection.

Biochem/physiol Actions

PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this gene is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3′ UTR have been detected, but the full-length nature of only two is known.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

PLUNC-like proteins display sequence homology with BPI (bactericidal/permeability-increasing protein) is a 456-residue cationic protein shown to possess both bactericidal and LPS (lipopolysaccharide)-binding activities. Palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts (PLUNC, LUNX, NASG, SPURT, SPLUNC1) appears to support antimicrobial and anti-inflammatory functions in Gram-negative bacteria-induced respiratory infection.

Immunogen

Synthetic peptide directed towards the middle region of human PLUNC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL

Specificity

Anti-PLUNC polyclonal antibody reacts with human, mouse, rat, pig, canine, and bovine PLUNC1 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PLUNC(51297)
mol wt28 kDa
NCBI accession no.NP_570913
Quality Level100
shipped inwet ice
species reactivityrat, bovine, guinea pig, goat, dog, human, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9NP55
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.