Anti-SLC20A2

Code: AV42318-100UL D2-231

Application

Anti-SLC20A2 polyclonal antibody is used to tag solute carrier family 20 (phosphate transporter) member 2/ gibbon ape leukemia virus 2 protein for detection and q...


 Read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Application

Anti-SLC20A2 polyclonal antibody is used to tag solute carrier family 20 (phosphate transporter) member 2/ gibbon ape leukemia virus 2 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 20 (phosphate transporter) member 2/gibbon ape leukemia virus 2 protein in Pi homeostasis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 20 (phosphate transporter), member 2 (SLC20A2, GLVR2, MLVAR, PIT-2) is a type III Na+-dependent Pi transporter responsible for the transport of inorganic phosphate (Pi) and maintenance of Pi homeostasis that supports biological processes such as nucleic acid synthesis, tooth mineralization, skeletal development and various signaling cascades. Defective SLC20a2 is associated with idiopathic basal ganglia calcification (Fahr′s syndrome).

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC20A2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

Specificity

Anti-SLC20A2 polyclonal antibody reacts with bovine, chicken, human, mouse, rat, canine, and zebrafish solute carrier family 20 (phosphate transporter) member 2 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC20A2(6575)
mol wt70 kDa
NCBI accession no.NP_006740
Quality Level100
shipped inwet ice
species reactivitybovine, guinea pig, rabbit, horse, dog, mouse, rat, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q08357
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.