Anti-FST

Code: AV42287-100UL D2-231

Application

Anti-FST polyclonal antibody is used to tag follistatin protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical...


 Read more

Your Price
€297.00 100UL
€297.00 inc. VAT

Application

Anti-FST polyclonal antibody is used to tag follistatin protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of follistatin in the regulation of TGF-β superfamily mediated processes such as those regulated by myostatin/GDF8 and activin.

Biochem/physiol Actions

Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Follistatin is an autocrine glycoprotein component of the inhibin-activin-follistatin axis that mediates many cellular processes via its ability to bind and neutralize members of the TGF-β superfamily such as activin and myostatin/GDF-8.

Immunogen

Synthetic peptide directed towards the C terminal region of human FST

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Specificity

Anti-FST polyclonal antibody reacts with canine, chicken, bovine, pig, human, mouse, rat, and zebrafish follistatin proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FST(10468)
mol wt35 kDa
NCBI accession no.NP_006341
Quality Level100
shipped inwet ice
species reactivityhorse, human, bovine, guinea pig, rabbit, mouse, dog, rat, goat, sheep
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q6FHE1
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.