Anti-ADH1B

Code: AV41787-100UL D2-231

Application

Anti-alcohol dehydrogenase-1B (ADH2) polyclonal antibody is used to tag alcohol dehydrogenase-1B protein(s)/subunits for detection and quantitation by Western blo...


 Read more

Your Price
€350.00 100UL
€430.50 inc. VAT

Application

Anti-alcohol dehydrogenase-1B (ADH2) polyclonal antibody is used to tag alcohol dehydrogenase-1B protein(s)/subunits for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.

Biochem/physiol Actions

ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Alcohol dehydrogenase-1B (ADH2) is an enzyme that metabolized a variety of substrates including ethanol, retinol, aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Alcohol dehydrogenase-1B is important in studies on alcoholism.

Immunogen

Synthetic peptide directed towards the C terminal region of human ADH1B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Specificity

Anti-alcohol dehydrogenase-1B (ADH2) reacts with the β-polypeptide of human alcohol dehydrogenase-1B.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ADH1B(125)
mol wt41 kDa
NCBI accession no.NP_000659
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P00325
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.