AV41699-100UL Display Image

Anti-PKLR

Code: AV41699-100UL D2-231

Application

Anti-PKLR antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Pyruvate kinase (PKLR) is needed for...


read more

Your Price
€400.00 100UL
€492.00 inc. VAT

Application

Anti-PKLR antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Pyruvate kinase (PKLR) is needed for energy generation in erythrocytes. Deficiency of PKLR in mice reduces the risk of blood-stage malarial parasite Plasmodium chabaudi induced infection.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Pyruvate kinase (PKLR) is a liver/erythrocyte-specific enzyme that exists as a tetramer. It comprises structural and functional domains namely N. A and C domains. The C domain is erythrocyte-specific and the A domain is active site residues. The PKLR gene is mapped to human chromosome 1q22.

Immunogen

Synthetic peptide directed towards the N terminal region of human PKLR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PKLR(5313)
mol wt58 kDa
NCBI accession no.NP_000289
Quality Level100
shipped inwet ice
species reactivitybovine, human, rat, dog, mouse, rabbit, pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P30613-2
This product has met the following criteria: