Anti-RNF8

Code: AV40071-100UL D2-231

Application

Anti-RNF8 polyclonal antibody is used to tag ring finger protein 8 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) t...


 Read more

Your Price
€337.00 100UL
€414.51 inc. VAT

Application

Anti-RNF8 polyclonal antibody is used to tag ring finger protein 8 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles ring finger protein 8 in processes such as DNA double-strand break (DSB) repair.

Biochem/physiol Actions

RNF8 contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins.The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Ring finger protein 8 (RNF8) is an E3 ubiquitin ligase which ubiquitinates proteins for degradation by proteosomes. RNF8 is involved in DNA double-strand break (DSB) repair, wherein RNF8 and RNF168 control the recruitment of 53BP1 to DNA damage sites and ubiquitination of histone-2A. RNF8 also mediates chromatin decondensation to create a local chromatin environment that is permissive to the assembly of checkpoint and repair machineries at DNA lesions.

Immunogen

Synthetic peptide directed towards the C terminal region of human RNF8

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENE

Specificity

Anti-RNF8 polyclonal antibody reacts with human, mouse, rat, and bovine ring finger protein 8 proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RNF8(9025)
mol wt55 kDa
NCBI accession no.NP_003949
Quality Level100
shipped inwet ice
species reactivitymouse, bovine, pig, horse, human, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O76064
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.