Anti-RXRG

Biochem/physiol Actions

RXRG belongs to the retinoid receptor family of nuclear receptors that mediate the cellular effects of retinoic acid. RXRG increases DNA binding and transcription of genes regulated by retinoic acid, thyroid hormone and vitamin D. Mutations in RXRG gene is reportedly associated with diabetic retinopathy.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human RXRG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT