Anti-TSFM

Code: AV38672-100UL D2-231

Biochem/physiol Actions

Ts translation elongation factor, mitochondrial (TSFM) is a guanine nucleotide exchange factor for EFTu during the elongation step of protein translat...


 Read more

Your Price
€337.00 100UL
€414.51 inc. VAT

Biochem/physiol Actions

Ts translation elongation factor, mitochondrial (TSFM) is a guanine nucleotide exchange factor for EFTu during the elongation step of protein translation in mitochondria. Mutations in TSFM gene results in combined oxidative phosphorylation deficiency-3 syndrome.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human TSFM

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVD

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TSFM(10102)
mol wt38 kDa
NCBI accession no.NP_005717
Quality Level100
shipped inwet ice
species reactivityhorse, bovine, human, rabbit, guinea pig, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P43897-2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.