Anti-FOXJ1

Code: AV38038-100UL D2-231

Biochem/physiol Actions

FOXJ1 is a member of forkhead/winged-helix transcription factor family, which play crucial roles during vertebrate development. FOXJ1 may play an impo...


read more

Your Price
€432.00 100UL
€531.36 inc. VAT

Biochem/physiol Actions

FOXJ1 is a member of forkhead/winged-helix transcription factor family, which play crucial roles during vertebrate development. FOXJ1 may play an important role in cell fate determination during lung development and in spermatogenesis.The unique pattern of FOXJ1expression during human fetal development suggests a role for this forkhead/winged-helix factor during pulmonary and renal epithelial development. Single nucleotide polymorphisms were identified in FOXJ1 and a significant association was found with allergic rhinitis.FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM].

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXJ1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FOXJ1(2302)
mol wt45 kDa
NCBI accession no.NP_001445
Quality Level100
shipped inwet ice
species reactivitydog, bovine, sheep, human, pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q92949
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.