Anti-KCNRG

Code: AV35503-100UL D2-231

Biochem/physiol Actions

KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.KCNRG...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Biochem/physiol Actions

KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels (see MIM 176260) and inhibits their function (Ivanov et al., 2003 [PubMed 12650944]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-818 AY169388.1 1-818 819-916 AY190922.1 599-696 917-1625 AY169388.1 819-1527

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human KCNRG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFF

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KCNRG(283518)
mol wt26 kDa
NCBI accession no.NP_775876
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q0P6D0
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.