Anti-GRIK2

Code: AV35340-100UL D2-231

Application

Rabbit Anti-GRIK2 antibody is suitable for western blot applications at a concentration of 2.5 µg/ml.

Biochem/physiol Actions

GR...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-GRIK2 antibody is suitable for western blot applications at a concentration of 2.5 µg/ml.

Biochem/physiol Actions

GRIK2 encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

GRIK2 is a ligand-gated, ion channel glutamate receptor that belongs to the kainite family. Genetic variations in GRIK2 have been linked to mental retardation, mania and obsessive compulsive disorder (OCD).Rabbit Anti-GRIK2 antibody recognizes canine, bovine, human, mouse, and rat GRIK2.

Immunogen

Synthetic peptide directed towards the N terminal region of human GRIK2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GRIK2(2898)
mol wt102 kDa
NCBI accession no.NP_068775
Quality Level100
shipped inwet ice
species reactivityhuman, rat, bovine, horse, dog, guinea pig, mouse, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q13002
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.