Anti-NMUR2

Code: AV35300-100UL D2-231

Application

Rabbit Anti-NMUR2 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml.

Biochem/physiol Actions

N...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Rabbit Anti-NMUR2 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml.

Biochem/physiol Actions

NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NMUR2 (neuromedin U receptor 2) belongs to the G-protein coupled receptor family. It is known to mediate anti-obesity effects by regulating food intake and body weight.Rabbit Anti-NMUR2 antibody recognizes human NMUR2.

Immunogen

Synthetic peptide directed towards the N terminal region of human NMUR2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NMUR2(56923)
mol wt46 kDa
NCBI accession no.NP_064552
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9GZQ4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.