Anti-CUL5

Code: AV35127-100UL D2-231

Biochem/physiol Actions

CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Disclaimer

Un...


 Read more

Your Price
€337.00 100UL
€414.51 inc. VAT

Biochem/physiol Actions

CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Cul5- part of the Cullin family of proteins. It exhibits anti-proliferative characteristics due to its function in the Ring E3 ligase complex of the ubquitin system. It is expressed highly in cardiac and skeletal tissues.

Immunogen

Synthetic peptide directed towards the C terminal region of human CUL5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CUL5(8065)
mol wt86 kDa
NCBI accession no.NP_003469
Quality Level100
shipped inwet ice
species reactivitybovine, mouse, horse, rabbit, dog, human, rat, guinea pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q93034
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.