Anti-HSF2BP

Code: AV34837-100UL D2-231

Application

Rabbit Anti-HSF2BP antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml).

Biochem/physiol Actions

HSF2 bin...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-HSF2BP antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml).

Biochem/physiol Actions

HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HSF2BP codes for a protein that binds to heat shock transcription factor 2 (HSF2) and may regulate HSF2 activity. Studies have reported that HSF2BP represses the transcriptional functions of BNC1.Rabbit Anti-HSF2BP antibody recognizes bovine, canine, human, mouse, and rat HSF2BP.

Immunogen

Synthetic peptide directed towards the N terminal region of human HSF2BP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVE

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HSF2BP(11077)
mol wt38 kDa
NCBI accession no.NP_008962
Quality Level100
shipped inwet ice
species reactivitymouse, dog, human, bovine, guinea pig, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O75031
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.