Anti-ZMYND11

Code: AV34704-100UL D2-231

Application

Rabbit Anti-ZMyND11 (AB1) antibody is suitable for western blot (2.5 µg/ml) and IHC (4-8 µg/ml) assays.

Biochem/physiol Actions

 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-ZMyND11 (AB1) antibody is suitable for western blot (2.5 µg/ml) and IHC (4-8 µg/ml) assays.

Biochem/physiol Actions

ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZMyND11 is a zinc-finger protein that links H3, 3K36me3 to tumor suppression and transcriptional elongation. ZMyND11 has also been implicated in poorly differentiated myeloid leukemia.Rabbit Anti-ZMyND11 antibody recognizes bovine, chicken, human, mouse, rat, and canine ZMyND11.

Immunogen

Synthetic peptide directed towards the middle region of human ZMYND11

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZMYND11(10771)
mol wt42 kDa
NCBI accession no.NP_997644
Quality Level100
shipped inwet ice
species reactivitydog, rat, human, mouse, bovine, guinea pig, rabbit, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q6PJR5
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.