Anti-TFB2M

Code: AV34471-100UL D2-231

Application

Rabbit Anti-TFB2M (AB1) antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

 Read more

Your Price
€350.00 100UL
€430.50 inc. VAT

Application

Rabbit Anti-TFB2M (AB1) antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

TFB2M is a mitochondrial transcription factor that regulates the expression of SERCA2 gene in rat cardiomyocytes. It is also known to induce the transcription of human mtDNA.Rabbit Anti-TFB2M (AB1) antibody recognizes human and rat TFB2M.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFB2M

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TFB2M(64216)
mol wt45 kDa
NCBI accession no.NP_071761
Quality Level100
shipped inwet ice
species reactivityhuman, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9H5Q4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.