Application
Rabbit Anti-FREQ antibody is suitable for western blot (0.5 µg/ml) and IHC (4-8 µg/ml) applications.
Biochem/physiol Actions
FREQ is a member of the neuronal calcium sensor gene family, which encode calcium-binding proteins expressed predominantly in neurons. The protein encoded by this gene regulates G protein-coupled receptor phosphorylation in a calcium-dependent manner and can substitute for calmodulin. This protein is thought to be associated with secretory granules and may be involved in the regulation of neurosecretion.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
FREQ (NCS1) is a neuronal calcium sensor that modulates G protein-coupled receptor (GPCR) phosphorylation and synaptic functions. Interaction between variation in the DRD2 and FREQ genes can be used to predict the efficacy of nicotine replacement therapy. Rabbit Anti-FREQ antibody recognizes bovine, human, mouse, rat, chicken, zebrafish FREQ.
Immunogen
Synthetic peptide directed towards the N terminal region of human FREQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK
This product has met the following criteria to qualify for the following awards: