Anti-PPARG

Code: AV32880-100UL D2-231

Application

Rabbit Anti-PPARG has been used at a dilution of 1:50 for IHC applications. It can also be used for western blot at 1.25 μg/ml.

Rabbit polyclonal anti-PPARG...


 Read more

Your Price
€370.00 100UL
€455.10 inc. VAT

Application

Rabbit Anti-PPARG has been used at a dilution of 1:50 for IHC applications. It can also be used for western blot at 1.25 μg/ml.

Rabbit polyclonal anti-PPARG (AB1) antibody is used to tag peroxisome proliferator-activated receptor gamma/glitazone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of peroxisome proliferator-activated receptor gamma/glitazone receptor in lipid and glucose metabolism, adipocyte differentiation and potential associated diseases such as diabetes, atherosclerosis, and cancer.

Biochem/physiol Actions

PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Peroxisome proliferator-activated receptor gamma/glitazone receptor (PPARG, NR1C3) is a type II nuclear receptor involved in the regulation of fatty acid storage and glucose metabolism. PPARG activation stimulates lipid uptake and adipocyte differention/adipogenesis. PPARG is a component of pathologies such as diabetes, atherosclerosis, and cancer. PPARG helps regulate the inflammatory response of endothelial cells.

Rabbit polyclonal anti-PPARG (AB1) antibody reacts with bovine, canine, human, mouse, rat, chicken, rabbit, and pig peroxisome proliferator-activated receptor gamma/glitazone receptors.

Immunogen

Synthetic peptide directed towards the N terminal region of human PPARG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PPARG(5468)
mol wt56 kDa
NCBI accession no.NP_005028
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, mouse, guinea pig, human, horse, dog
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P37231
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.