Anti-PIAS3

Code: AV32762-100UL D2-231

Application

Rabbit Anti-PIAS3 antibody can be used for western blot (1.0-2.0 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-PIAS3 antibody can be used for western blot (1.0-2.0 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

PIAS3 is a transcription factor that facilitates protein SUMOylation. It inhibits STAT3-mediated signaling and studies have reported that its overexpression can induce apoptosis in prostate cancer cells. PIAS3 can also function as a biomarker for human cancer.Rabbit Anti-PIAS3 antibody recognizes human, rat, canine, mouse, and bovine PIAS3.

Immunogen

Synthetic peptide directed towards the C terminal region of human PIAS3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PIAS3(10401)
mol wt67 kDa
NCBI accession no.NP_006090
Quality Level100
shipped inwet ice
species reactivityhuman, bovine, dog, rat, pig, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9Y6X2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.