AV32536-100UL Display Image

Anti-CCRN4L

Code: AV32536-100UL D2-231

Application

Rabbit Anti-CCRN4L antibody can be used for western blot applications at a concentration of 1-2µg/ml. It can also be used for IHC assays at 4-8µg/ml, us...


read more

Your Price
€388.00 100UL
€477.24 inc. VAT

Application

Rabbit Anti-CCRN4L antibody can be used for western blot applications at a concentration of 1-2µg/ml. It can also be used for IHC assays at 4-8µg/ml, using paraffin-embedded tissues.

Biochem/physiol Actions

CCRN4L is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CCRN4L is a protein coding gene that is similar to a circadian clock gene, Nocturnin, and may be involved in regulating circadian functions.Rabbit Anti-CCRN4L antibody recognizes bovine, rat, mouse, and human CCRN4L.

Immunogen

Synthetic peptide directed towards the N terminal region of human CCRN4L

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CCRN4L(25819)
mol wt48 kDa
NCBI accession no.NP_036250
Quality Level100
shipped inwet ice
species reactivityhorse, guinea pig, bovine, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9UK39
This product has met the following criteria: