AV32519-100UL Display Image

Anti-FOSB

Code: AV32519-100UL D2-231

Application

Rabbit Anti-FOSB antibody can be used for IHC (4-8µg/ml) and western blot (1.25µg/ml) applications.

Biochem/physiol Actions


read more

Your Price
€443.00 100UL
€544.89 inc. VAT

Application

Rabbit Anti-FOSB antibody can be used for IHC (4-8µg/ml) and western blot (1.25µg/ml) applications.

Biochem/physiol Actions

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. They are leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

FOSB is a leucine zipper protein that functions as a transcriptional regulator. Studies in mice have reported that FOSB is involved in cocaine-induced behavioral responses.Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.

Immunogen

Synthetic peptide directed towards the C terminal region of human FOSB

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVL

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FOSB(2354)
mol wt36 kDa
NCBI accession no.NP_006723
Quality Level100
shipped inwet ice
species reactivitybovine, horse, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P53539
This product has met the following criteria: