Anti-DLX2

Code: AV32212-100UL D2-231

Application

Rabbit Anti-DLX2 (AB2) antibody can be used for western blot assays at 2.5µg/ml. It can also be used for IHC at 4-8µg/ml using paraffin-embedded tissues...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-DLX2 (AB2) antibody can be used for western blot assays at 2.5µg/ml. It can also be used for IHC at 4-8µg/ml using paraffin-embedded tissues.

Biochem/physiol Actions

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Dlx2 is a homeobox gene that is involved in the patterning of branchial arches and dentition in mice.Rabbit Anti-DLX2 (AB1) antibody recognizes canine, human, rat, bovine and mouse DLX2.

Immunogen

Synthetic peptide directed towards the C terminal region of human DLX2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DLX2(1746)
mol wt27 kDa
NCBI accession no.NP_004396
Quality Level100
shipped inwet ice
species reactivityrat, bovine, guinea pig, human, dog, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q07687
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.