Anti-ZNFN1A2

Code: AV31676-100UL D2-231

Application

Rabbit polyclonal anti-ZNFN1A2 antibody is used to tag helios/IKAROS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochem...


read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit polyclonal anti-ZNFN1A2 antibody is used to tag helios/IKAROS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of helios/IKAROS family zinc finger 2 in early onset regulation of lymphocyte development.

Rabbit anti-ZNFN1A2 can be used for western blot (5.0µg/ml) and immunohistochemistry (4-8µg/ml, using paraffin-embedded tissues) applications.

Biochem/physiol Actions

Novel short isoforms of this gene, ZNFN1A2, are overexpressed in a patient with T-cell acute lymphoblastic leukemia and may contribute to the development of T-cell malignancies.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Studies have reported that ZNFN1A2 has been deregulated in human leukemias.

Helios/IKAROS family zinc finger 2 (ANF1A2, ZNF1A2, ZNFN1A2), a member of the Ikaros family of zinc-finger transcription factors, is a hematopoietic-specific transcription factors involved in the regulation of early lymphocyte development. Helios can form homodimers and heterodimers with other Ikaros family members to differentially regulate hematopoietic development.

Rabbit polyclonal anti-ZNFN1A2 antibody reacts with human, mouse, rat, chicken, and canine Helios/IKAROS family zinc finger 2 transcription factors.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZNFN1A2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZNFN1A2(22807)
mol wt43 kDa
NCBI accession no.NP_001072994
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q6PQC7
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.