Anti-ELF2

Code: AV31638-100UL D2-231

Application

Rabbit Anti-ELF2 antibody can be used for western blot assays at concentration of 0.5µg/ml.

Biochem/physiol Actions

The ELF2 gen...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Rabbit Anti-ELF2 antibody can be used for western blot assays at concentration of 0.5µg/ml.

Biochem/physiol Actions

The ELF2 gene encodes a protein that physically interacts with AML1 and mediates opposing effects on AML1-mediated transcription of the B cell-specific blk gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ELF2 is a transcription factor that belongs to the Eph ligand family of proteins. This transcription factor is known to be expressed in the hind brain and newly forming somites of the mouse embryo. Rabbit Anti-ELF2 antibody recognizes chicken, human, mouse, rat, and canine ELF2.

Immunogen

Synthetic peptide directed towards the N terminal region of human ELF2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ELF2(1998)
mol wt57 kDa
NCBI accession no.NP_973728
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, guinea pig, human, bovine, dog, horse, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q15723-3
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.